This is a working overview of MC1R, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-05-14. Anything still debated is marked as such rather than presented as settled.
Melanotan-2, also written Melanotan II, is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, and the lactam bridge between the aspartate and lysine side chains constrains the peptide into a ring. This structural change increases receptor affinity and metabolic stability relative to the native hormone. The compound was created in the 1980s as a research tool for studying pigmentation biology.
Melanocytes are the pigment-producing cells of the skin, and they carry melanocortin-1 receptors on their surface. When the receptor is activated, cyclic adenosine monophosphate rises inside the cell and raises the activity of enzymes such as tyrosinase, which increases melanin output. Melanotan-2 binds melanocortin-1 receptors in vitro and in animal models, and this binding is generally described as the basis for the tanning effect. Other receptors account for different effects: melanocortin-4 receptors contribute to appetite and erectile signalling, while melanocortin-3 and melanocortin-5 receptors contribute to energy balance and exocrine function.
Early published reports described melanotan-2 as a tanning agent without sun protection, which means darkening is not the same as protection against ultraviolet radiation. Later studies explored the peptide in erectile dysfunction, hemorrhagic shock, and some skin conditions. No regulator in the United States or Europe has approved it for clinical use. Many products labelled melanotan-2 are sold without approval and their identity and purity are unverified. Its long-term safety in humans remains an open question.
Reversed-phase high-performance liquid chromatography is the routine method for purity assessment. Peptides absorb near 214 nm because of the peptide bond, and a gradient of acetonitrile in water separates the intact peptide from deletion sequences, oxidised products, and earlier-eluting fragments at neutral pH. Electrospray ionisation mass spectrometry provides an orthogonal check: the measured mass must agree with the theoretical value. Amino acid analysis and peptide mapping confirm structure but are used less often. Reference standards remain scarce because the peptide is not described in any pharmacopoeia.
Regulatory treatment varies by country. In the United States the peptide is not approved as a medicine, and products offered for human use may be treated as unapproved new drugs; some states also restrict sale. Australia, the United Kingdom, and European Union member states apply comparable restrictions to unapproved peptide products. Border agencies have seized shipments labelled as research chemicals. Classification may change over time, and the legal position for personal importation is not clearly settled in most published guidance.
| Property | Value | Notes |
|---|---|---|
| Compound class | Synthetic cyclic heptapeptide | Alpha-MSH analogue containing a D-phenylalanine residue |
| Molecular formula | C50H69N15O9 | Average molecular mass approximately 1024.2 g/mol |
| Appearance | White to off-white lyophilised powder | Normally supplied as a freeze-dried solid in a sealed vial |
| Solubility | Freely soluble in water and polar solvents | Dissolves readily in aqueous buffers and in alcohol-water mixtures |
| Receptor targets | MC1R, MC3R, MC4R, MC5R | Acts as a non-selective melanocortin receptor agonist |
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography with ultraviolet detection, often paired with mass spectrometry. Retention time supports identity, while the mass spectrum confirms the molecular weight of the intact peptide. Purity is frequently reported as a percentage of total peak area, a figure that depends on the wavelength, column and gradient used. Impurity profiling may also look for truncated sequences, oxidised forms and residual counterions. Amino acid analysis and peptide mapping provide orthogonal confirmation when required.
Regulatory status varies by jurisdiction, and the substance is frequently described as unapproved for therapeutic use. Some authorities classify it alongside prescription-only medicines or controlled categories, while others address it through general consumer protection rules. Analytical surveys have reported mismatches between label claims and measured content in products sold online, although the scope of such testing is limited. Whether these discrepancies are widespread remains an open question. Discussion in the literature therefore tends to combine chemistry, supply-chain observation and policy analysis.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
=== Battery electrolyte === Chitosan is being investigated as an electrolyte for rechargeable batteries with good performance and low environmental impact due to rapid biodegradability, leaving recycleable zinc. The electrolyte has excellent physical stability up to 50 °C, electrochemical stability up to 2 V with zinc electrodes, and accommodates redox reactions involved in the Zn-MnO2 alkaline system. As of 2022 results were promising, but the battery needed testing on a larger scale and under actual use conditions.
Examining rodents and their offspring, Brenner has showed that rodent postpartum mothers are under severe metabolic stress to their NAD system. Supplementing rodent mothers with NR increases maternal weight loss, advances juvenile development and provides long lasting neurodevelopmental advantages into adulthood. Considering citrin deficiency as a lean MASLD syndrome, he identified accumulation of glycerol-3-phosphate and activation of ChREBP as the mechanism of both elevated expression of FGF21 and elevated lipogenic transcription in this rare disease. Brenner is an author of more than 200 peer-reviewed publications. He was the senior editor of the 2004 book, Oncogenomics: Molecular Approaches to Cancer. Brenner is both cautious and critical of research that promotes claims of anti-aging and longevity. After writing a favorable review of Steven Austad's book Methuselah's Zoo, he reviewed Lifespan: Why We Age – and Why We Don't Have To by David A. Sinclair, summarizing it as "an influential source of misinformation on longevity, featuring counterfactual claims about longevity genes being conserved between yeast and humans, the existence of supposed activators of these genes, and claimed successful age reversal in mice based on partial reprogramming." Brenner published a major review of sirtuins in 2022 entitled "Sirtuins are not conserved longevity genes".
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
In 1979, IUPAC suggested systematic element names to be used as placeholders until permanent names were established; under it, element 105 would be unnilpentium, from the Latin roots un- and nil- and the Greek root pent- (meaning "one", "zero", and "five", respectively, the digits of the atomic number). Both teams ignored it as they did not wish to weaken their outstanding claims. In 1981, the Gesellschaft für Schwerionenforschung (GSI; Society for Heavy Ion Research) in Darmstadt, Hesse, West Germany, claimed synthesis of element 107; their report came out five years after the first report from JINR but with greater precision, making a more solid claim on discovery. GSI acknowledged JINR's efforts by suggesting the name nielsbohrium for the new element. JINR did not suggest a new name for element 105, stating it was more important to determine its discoverers first.
Sources: en.wikipedia.org
=== Pharmacodynamics === 3,4-DMA has been assessed in various biochemical and preclinical studies. Its affinity (Ki) for the rat serotonin 5-HT2A receptor has been assessed and was found to be 43,300 nM. For comparison, the affinity of para-methoxyamphetamine (PMA) was 33,600 nM, of 2,5-dimethoxyamphetamine (2,5-DMA) was 5,200 nM, and of 2,5-dimethoxy-4-methylamphetamine (DOM) was 100 nM in the same study. 3,4-DMA also showed affinity for the 5-HT1 receptor (Ki = 64,600 nM). The drug has additionally been found to be a monoamine oxidase inhibitor (MAOI), with an IC50Tooltip half-maximal inhibitory concentration of 20,000 nM for monoamine oxidase A (MAO-A), whereas it was inactive at monoamine oxidase B (MAO-B) (IC50 > 100,000 nM). 3,4-DMA does not produce hyperlocomotion and hence lacks stimulant-like effects in rodents. It also fails to produce stimulus generalization to dextroamphetamine in rodent drug discrimination tests, likewise suggesting that it lacks stimulant- or amphetamine-like effects. The drug partially but incompletely substituted for DOM in rodents, suggesting that it may lack psychedelic-like effects. 3,4-DMA partially to fully substituted for partially to fully substituted for PMMA, MDMA, and MDA in rodents, suggesting that it may have entactogen-like effects.
=== Other Elements === The expression vector is transformed or transfected into the host cell for protein synthesis. Some expression vectors may have elements for transformation or the insertion of DNA into the host chromosome, for example the vir genes for plant transformation, and integrase sites for chromosomal integration . Some vectors may include targeting sequence that may target the expressed protein to a specific location such as the periplasmic space of bacteria.
== Energy requirements == The energy required to heat water is significantly lower than that needed to vaporize it, for example for steam distillation and the energy is easier to recycle using heat exchangers. The energy requirements can be calculated from steam tables. For example, to heat water from 25 °C to steam at 250 °C at 1 atm requires 2869 kJ/kg. To heat water at 25 °C to liquid water at 250 °C at 5 MPa requires only 976 kJ/kg. It is also possible to recover much of the heat (say 75%) from superheated water, and therefore energy use for superheated water extraction is less than one sixth that needed for steam distillation. This also means that the energy contained in superheated water is insufficient to vaporise the water on decompression. In the above example, only 30% of the water would be converted to vapour on decompression from 5 MPa to atmospheric pressure.
==== 17 April 2012 massacre ==== Dismembered remains of 14 men were found in several plastic bags inside a Chrysler Voyager in the border city of Nuevo Laredo, Tamaulipas, on 17 April 2012. All of those killed were between the ages of 30 and 35. Officials stated that they found a "message signed by a criminal group", but they did not release the content of the note, nor if those killed were members of Los Zetas or of the Gulf Cartel. CNN en Español stated that the message left behind by the criminal group said that they were going to "clean up Nuevo Laredo" by killing Zeta members. The Monitor newspaper, however, said that a source outside of law enforcement but with direct knowledge of the attacks stated the 14 bodies belonged to members of Los Zetas who had been killed by the CJNG, now a branch of the Sinaloa Cartel. Following the attacks, the Sinaloa cartel's kingpin, Joaquín Guzmán Loera—better known as El Chapo Guzmán—sent a message to Los Zetas that they will fight for the control of the Nuevo Laredo plaza. The message read the following:
One example, in which both plant and animal alkanes play a role, is the ecological relationship between the sand bee (Andrena nigroaenea) and the early spider orchid (Ophrys sphegodes); the latter is dependent for pollination on the former. Sand bees use pheromones in order to identify a mate; in the case of A. nigroaenea, the females emit a mixture of tricosane (C23H48), pentacosane (C25H52) and heptacosane (C27H56) in the ratio 3:3:1, and males are attracted by specifically this odor. The orchid takes advantage of this mating arrangement to get the male bee to collect and disseminate its pollen; parts of its flower not only resemble the appearance of sand bees but also produce large quantities of the three alkanes in the same ratio as female sand bees. As a result, numerous males are lured to the blooms and attempt to copulate with their imaginary partner: although this endeavor is not crowned with success for the bee, it allows the orchid to transfer its pollen, which will be dispersed after the departure of the frustrated male to other blooms.
Sources: en.wikipedia.org
== Bibliography == Oberg, Erik; Jones, Franklin D.; Horton, Holbrook L.; Ryffel, Henry H. (1996), Green, Robert E.; McCauley, Christopher J. (eds.), Machinery's Handbook (25th ed.), New York: Industrial Press, ISBN 978-0-8311-2575-2, OCLC 473691581.
Following his death, Logan appears posthumously in two recordings - the first for the assisted living community Living+ and the second an archival recording of a dinner party with his employees and Connor, of which his children Kendall, Roman, and Shiv become emotional upon viewing.
Risks include permanent scarring, infections, bleeding, irritation, and nerve damage leading to increased or decreased sensitivity. A change in requirements of publicly funded Australian plastic surgery requiring women to be told about natural variation in labias led to a 28% reduction in the number of surgeries performed. Unlike public hospitals, cosmetic surgeons in private practice are not required to follow these rules, and critics say that "unscrupulous" providers are charging to perform the procedure on women who would not want it if they had more information. Images of vulvae are absent from the popular media and advertising and do not appear in some anatomy textbooks, while community opposition to sex education limits the access that young women have to information about natural variation in labias. Many women have limited knowledge of vulval anatomy, and are unable to say what a "normal" vulva looks like. At the same time, many pornographic images of women's genitals are digitally manipulated, changing the size and shape of the labia to fit with the censorship standards in different countries. Medical researchers have raised concerns about the procedure and its increasing prevalence rates, with some speculating that exposure to pornography images on the Internet may lead to body image dissatisfaction in some women. Although it is also suggested that evidence for this is lacking, the National Health Service stated that some women bring along advert or pornographic images to illustrate their desired genital appearance.
=== Artificial retina === The artificial retina of Professor José Sahel and his team at the Quinze-Vingts National Ophthalmology Hospital Centre aims to allow people with degenerative retinal disease, numbering 1.5 million in 2008, to accomplish everyday activities. Placed under the existing retina, it directly stimulates the neurons, replacing defective cells. These implants should eventually allow patients to recognize faces, read large print and move independently in a restricted environment. The challenge for the Altran teams was to find solutions to produce artificial retina in series, in order to bring solutions to the widest number of patients.
Sources: en.wikipedia.org
No. It is a laboratory-made peptide, while the natural hormone is alpha-melanocyte-stimulating hormone, a longer peptide produced by the pituitary gland and by skin cells. Melanotan-2 mimics only a short active region of that hormone and contains non-natural residues such as D-phenylalanine.
No approved regulatory indication exists in major markets. An approval exists for a different peptide, afamelanotide, which is used for a rare photosensitivity disorder called erythropoietic protoporphyria. Melanotan-2 itself remains a research compound with no cleared clinical role.
Melanocortin-1 receptors on melanocytes are the receptor most closely linked to pigment production. The peptide is not selective, however, and also activates melanocortin-3, melanocortin-4, and melanocortin-5 receptors. That lack of selectivity is the usual explanation offered for both its range of observed effects and its off-target effects.
Low temperature slows hydrolysis and oxidation, the two main routes by which the peptide backbone and side chains are modified. A lyophilised powder stored at −20 °C is more stable than one kept at room temperature, and once the material is dissolved the degradation rate rises, making refrigeration more important.